LLLVALAVAYAVPDPRGVIINLEAGEICLNSAQCKSECCHQESSLSLARCAAKASENSECSAWTLYGVYYKCPCERGLTCQVDKTLVGSIMNTNFGICFDAARSEE COLA_HORSE Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase. CLPS1 Colipase A (Fragment) 106 Enterostatin has a biological activity as a satiety signal.